EMBL-EBITop pageQuery Manager pageResults pageSession Manager pageView Manager pageDataBanks Information PageHelp PageLion Bioscience UK
Text Entry | EmblEntry
                                       
This entry is from:
EMBL
Save
Link
Launch
Printer_Friendly
EMBL:AF051091
ID   AF051091   standard; DNA; PRO; 2439 BP.
XX
AC   AF051091;
XX
SV   AF051091.1
XX
DT   02-APR-1998 (Rel. 55, Created)
DT   06-APR-1998 (Rel. 55, Last updated, Version 2)
XX
DE   Xanthomonas campestris DNA modification methyltransferase M.XmaI (xmaIM)
DE   and restriction endonuclease R.XmaI (xmaIR) genes, complete cds.
XX
KW   .
XX
OS   Xanthomonas campestris
OC   Bacteria; Proteobacteria; gamma subdivision; Xanthomonas group;
OC   Xanthomonas.
XX
RN   [1]
RP   1-2439
RA   Lunnen K.D., Wilson G.G.;
RT   ;
RL   Submitted (25-FEB-1998) to the EMBL/GenBank/DDBJ databases.
RL   New England Biolabs Inc., 32 Tozer Road, Beverly, MA 01915, USA
XX
DR   SPTREMBL; O68565; O68565.
DR   SPTREMBL; O68566; O68566.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2439
FT                   /db_xref="taxon:339"
FT                   /organism="Xanthomonas campestris"
FT                   /strain="malvacaerum"
FT   CDS             189..1091
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O68565"
FT                   /note="belongs to the beta family of N-4 cytosine
FT                   DNA-MTases; similar to homomethylomers M.SmaI, M.Cfr9I and
FT                   M.XcyI"
FT                   /transl_table=11
FT                   /gene="xmaIM"
FT                   /function="recognizes ds DNA sequence CCCGGG; methylates
FT                   second cytosine at the N-4 position (CmCCGGG); methylates
FT                   both strands of the duplex, one strand at a time"
FT                   /product="DNA modification methyltransferase M.XmaI"
FT                   /protein_id="AAC08981.1"
FT                   /translation="MPKANTAPPSGVERILRPEPLILRGSTLFEGDALTVLRRLPSGSV
FT                   RCVVTSPPYWGLRDYGIEEQIGLEVTMPQFLHRLVAIFAEVKRVLTDDGTLWLNIGDGY
FT                   TSGNRGYRAPDKKNPARAMDVRPDTPVGLKPKDLMGIPWRLAFALQDDGWYLRSDIVWN
FT                   KPNAMPESVKDRPARSHEFLFMFTKSEKYFYDWQAAREPADGGGLRNRRSVWNVNTKPF
FT                   AGAHFATFPPELIRPCIHASTEPGDYVLDPFFGSGTVGLVCQDENRQYVGIELNPEYVT
FT                   LAADRLQGQNSNVIRIAAA"
FT   RBS             1072..1077
FT                   /gene="xmaIR"
FT   CDS             1088..2089
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:O68566"
FT                   /note="similar to homoschizomers R.Cfr9I and R.XcyI, but
FT                   not to heteroschizomer R.SmaI"
FT                   /transl_table=11
FT                   /gene="xmaIR"
FT                   /function="recognizes ds DNA sequence CCCGGG; cleaves both
FT                   strands of the duplex thus: C/CCGGG"
FT                   /product="restriction endonuclease R.XmaI"
FT                   /protein_id="AAC08982.1"
FT                   /translation="MTTPNKINFPPPKLQIDFAFALKRFRAVYLQSALLETVRDMDIAE
FT                   LDRQLSKYVPPADLATLAQYGLRAELLFAVPAVLEANPHLLGYYRLLMGYSQKEFYGRD
FT                   KGFGVGCFKSMEEKGKAGKAAVADLHDLCVAFCATASALLAGVGPLRVSRELLDDLTLL
FT                   TVGPQLRGGANNQRGADGIVLVFEIIREIVAHAAAEVRESAIEVNSATGRPVLIEFAPD
FT                   PDIIIREEMENQHYRNVVAIEVKSGTDVSNIHNRIGEAEKSHQKARQRGFTECWTVVNV
FT                   GRLDMVKARSESPSTDRFYSLTALSLRAGDEYADFRRRVLSLTAIPARPANP"
XX
SQ   Sequence 2439 BP; 515 A; 718 C; 704 G; 501 T; 1 other;
     ggtcgcggaa ctccgatggc cagatgaatt gggaacgccg gccatgtgag gcgttatccg        60
     taggcctgcc ctacaccccg gatcagtgac cattgcaggc tcgctgggcg gtggaagtaa       120
     gattggctca acgattttca agcattgcgg catggtgcag ccgcgccacg attgagagaa       180
     caaacaacat gccaaaagca aacacagccc cgccgtctgg cgtggagcga attctgcgcc       240
     ctgagccgct catcttgcgc ggctcaacgc tttttgaagg ggatgccctg acagtactgc       300
     ggcgcctgcc atccgggtct gtgcgctgtg tagtcacttc gccgccctat tgggggctgc       360
     gtgactacgg gatcgaagag cagatcggcc ttgaagtcac catgccccaa tttctgcacc       420
     gattggtggc catctttgcc gaagttaagc gcgttctgac cgatgacggc accctttggc       480
     tgaatatcgg tgacggctac acgagcggca atcgcggcta tcgcgcacct gacaagaaga       540
     accccgcccg tgcgatggac gttcgccctg acactccagt gggcttgaaa ccaaaagact       600
     tgatgggtat tccctggcgg ttggccttcg ccttgcagga tgacggctgg tatctgcgca       660
     gtgacattgt ttggaacaag ccaaatgcga tgccggagag cgtaaaagat cgccctgccc       720
     gctcgcatga gttccttttc atgttcacca agtcggaaaa atatttttac gactggcagg       780
     cagctcgaga gccagcagac ggtggcggcc tacgcaatcg ccgctcagtt tggaatgtaa       840
     acaccaagcc ctttgccggt gcccacttcg ctaccttccc acccgaattg atccggcctt       900
     gcatccacgc atcgaccgaa cccggggatt acgtgctcga tccgttcttt ggttctggaa       960
     ccgtgggcct cgtatgccag gacgaaaacc ggcagtacgt gggaattgaa ctcaaccccg      1020
     aatatgtgac cttggcggct gatcgcctgc aagggcagaa cagcaacgtg ataaggatcg      1080
     ccgccgcatg acgaccccca ataagatcaa tttcccgccg cctaagttgc aaatcgactt      1140
     cgcctttgct ctcaaacgat tccgcgctgt ttacctgcaa agcgccttgc tggaaacggt      1200
     gcgcgacatg gacattgccg agcttgatcg gcagcttagc aagtacgttc ccccggcaga      1260
     cttggcgacc ctcgcgcagt acggcctacg ggccgaactg ctgtttgccg tgccggccgt      1320
     actggaggcg aatccccacc tgctgggcta ttaccggctg ctgatgggct acagtcagaa      1380
     agagttttac gggcgtgaca agggtttcgg cgttggctgc ttcaagtcga tggaggaaaa      1440
     aggcaaagcc ggtaaggcgg cagtggccga cctgcacgat ttgtgtgtgg ctttttgcgc      1500
     cacggcatca gcgttgctgg ccggagtcgg cccgctgcgt gtcagccggg aattgctgga      1560
     tgacttgacc ctgctaaccg ttggcccgca gctacgcggc ggagccaaca accagcgcgg      1620
     cgccgatggc atcgtgttgg tgttcgagat catccgggag attgtcgccc atgcggccgc      1680
     cgaagtacgg gaaagcgcca tcgaagtgaa cagcgctacg ggccgccctg ttctgatcga      1740
     gtttgcaccg gacccggaca tcatcattcg ggaggaaatg gagaaccagc attaccgcaa      1800
     cgtggttgcc atcgaagtca agagcggcac ggacgtttcc aacatccaca accgcatcgg      1860
     tgaggccgaa aaaagccacc aaaaggcacg acagcgcggc tttactgagt gctggactgt      1920
     ggtcaatgtc gggcggctgg atatggtaaa ggcccgtagc gaatcgccat cgaccgaccg      1980
     tttctattcg ctgaccgcgc tttctctcag ggccggcgac gaatacgccg actttcggcg      2040
     gcgggttcta tcgctaacag cgattccagc ccgccctgct aatccatgat gggattcagc      2100
     cgacatacgt gtaaaaatga ctcacagagt ctgacttcgc cttttaaatc atggggttga      2160
     cggataaaaa cgccggctgc cactcgcaat atcgcctgat gtcatgtcat gtgatcccac      2220
     cgagccggct gccgggcatc gggcgctcag cttcccctgg caaggtattc gtcgcactcg      2280
     angcgatctg cgctaccgcc gagtcagcag catccggtcg ggctagcaac acgccctgat      2340
     ctcagcgatc tgggagctgc tgggaatgag ttcgctcggg ctttcccaca tcagtcaatc      2400
     aacaccggat acaaccatct ggccgcttcc ggccattct                             2439
//

SRS 6.1.3.11 |  feedback