NCBI Nucleotide banner
PubMed Nucleotide Protein Genome Structure PopSet Taxonomy OMIM Books
 Search for
  Limits Preview/Index History Clipboard Details
You need JavaScript to work with this page.
       
1: X17022. Citrobacter freun...[gi:40463] Links
LOCUS       CFCFR91                 2284 bp    DNA     linear   BCT 26-MAY-1994
DEFINITION  Citrobacter freundii (RFL9) cfr9IM gene for DNA
            (Cytosine-4)-Methyltransferase.
ACCESSION   X17022
VERSION     X17022.1  GI:40463
KEYWORDS    cytosine methyltransferase.
SOURCE      Citrobacter freundii.
  ORGANISM  Citrobacter freundii
            Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;
            Citrobacter.
REFERENCE   1  (bases 1 to 2284)
  AUTHORS   Klimasauskas,S., Timinskas,A., Menkevicius,S., Butkiene,D.,
            Butkus,V. and Janulaitis,A.
  TITLE     Sequence motifs characteristic of
            DNA[cytosine-N4]methyltransferases: similarity to adenine and
            cytosine-C5 DNA-methylases
  JOURNAL   Nucleic Acids Res. 17 (23), 9823-9832 (1989)
  MEDLINE   90098846
   PUBMED   2690010
REFERENCE   2  (bases 1 to 2284)
  AUTHORS   Lubys,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-MAR-1992) Institute of Biotechnology, Gene
            Engineering Department, Graiciuno 8, Vilnius, Lithuania, 2028
REFERENCE   3  (bases 1 to 2284)
  AUTHORS   Lubys,A., Menkevicius,S., Timinskas,A., Butkus,V. and Janulaitis,A.
  TITLE     Cloning and analysis of translational control for genes encoding
            the Cfr9I restriction-modification system
  JOURNAL   Gene 141 (1), 85-89 (1994)
  MEDLINE   94215893
   PUBMED   8163180
FEATURES             Location/Qualifiers
     source          1..2284
                     /organism="Citrobacter freundii"
                     /strain="RFL9"
                     /db_xref="taxon:546"
                     /clone="clone pCfr9IRM2.3"
     gene            281..1183
                     /gene="cfr9IM"
     CDS             281..1183
                     /gene="cfr9IM"
                     /function="Methyl transfer"
                     /standard_name="Cfr9I methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA  (Cytosine-4)-Methyltransferase"
                     /protein_id="CAA34887.1"
                     /db_xref="GI:40464"
                     /db_xref="SWISS-PROT:P14243"
                     /translation="MPSKKSSSPLSVEKLHRSEPLELNGATLFEGDALSVLRRLPSGS
                     VRCIVTSPPYWGLRDYGIDEQIGLESSMTQFLNRLVTIFSEAKRVLTDDGTLWVNIGD
                     GYTSGNRGYRAPDKKNPARAMAVRPDTPEGLKPKDLIGIPWRLAFALQEDGWYLRSDI
                     VWNKPNAMPESVKDRPTRSHEFLFMLTKSEKYYYDWEAVREEKDSGGFRNRRTVWNVN
                     TKPFAGAHFATFPTELIRPCILASTKPGDYVLDPFFGSGTVGVVCQQEDRQYVGIELN
                     PEYVDIAVNRLQGEDTNVIRIAAA"
     gene            1180..2172
                     /gene="cfr9IR"
     CDS             1180..2172
                     /gene="cfr9IR"
                     /function="DNA cleavage"
                     /standard_name="Cfr9I restriction  endonuclease"
                     /codon_start=1
                     /evidence=experimental
                     /transl_table=11
                     /product="Restriction  Endonuclease"
                     /protein_id="CAA34888.1"
                     /db_xref="GI:40465"
                     /db_xref="SWISS-PROT:Q60132"
                     /translation="MTNKIVFPEPKQQVDFAFSLKRFRGIYLQNALLETVRDMDIVAL
                     DTQLAEYVNKADLATLATYGLRAELLFPVPVLLETNPFLLGYYRLLMGYSQKEFYGKD
                     KGFNAGCFKSMEVKGNIGKVAKPKISELCHAFCSVASSLLQGVGPLRISRELLDDLTL
                     LTVGPQLRGGANNQRGADGIVLVFEIIKEIVSHAVAEVRENAIEVNSATGRNVLIEFA
                     PDPDIIIREEMSLDNYRNVVAIEVKSGTDVSNIHNRIGEAEKSHQKARGHGYTECWTV
                     VNVSRLDMDKARKESPSTNRFYSITDLSLREGEQYEDFRRRVLSLTAISAAPTP"
BASE COUNT      624 a    438 c    570 g    652 t
ORIGIN      
        1 aagggaagcc taaccagacc gggaaagggt ctggctctgc cgtggtgttc accgagccat
       61 aaacgatcgg tactcgataa gagagcggtt aactgacaat ctgatgatac gccccggcgc
      121 ttttgttggt atgcccaaaa cggcgctaaa cggtcgctat tgtctgcttt tagttcggta
      181 aggctgttgt tggagtatct gatgacgttt acactactgg cccagataga tttaaaagtt
      241 gtaggttgtt gcatgtctgc attgtgcgtg aggaatattt atgccaagta aaaagagtag
      301 ttcgccgctg agtgttgaga aacttcatcg ttctgagccc ttggagttga acggagctac
      361 gctttttgaa ggtgatgctc tgtcagtatt gaggagactt ccgagcggct cagttcggtg
      421 catcgtcact tctccgccat actgggggct acgtgattac ggcatagatg aacaaatcgg
      481 tttagaaagt agcatgactc agtttttaaa tcgtcttgtt acgatctttt ctgaggcgaa
      541 acgtgtattg actgacgacg gaacgctatg ggttaacatt ggtgatggat atacaagcgg
      601 aaatcgcggg tatagagctc ctgataagaa aaatccggca cgagctatgg ctgttcgccc
      661 ggatacgcca gaaggactaa aaccgaagga tctgattggg attccttggc ggttagcgtt
      721 cgctttgcaa gaagatgggt ggtacctacg aagcgacatt gtttggaata aacctaacgc
      781 gatgcctgaa agtgtaaaag accggcctac ccgttctcat gagttccttt ttatgctgac
      841 caaatcagag aaatattatt acgattggga agcggtgaga gaagaaaaag atagcggagg
      901 tttcagaaat cgacgcacag tatggaatgt aaatacgaaa ccttttgcag gggctcattt
      961 cgcaacattc ccaacggagc taattcgtcc atgcatcttg gcatccacga aacctggtga
     1021 ttacgtatta gatccattct tcggctctgg tactgtaggc gttgtatgcc agcaggaaga
     1081 ccgccagtat gttggtattg aactcaatcc agaatatgtt gatatagctg taaatcgttt
     1141 gcagggtgag gatacaaatg tgataaggat cgcggcagca tgactaataa aatagttttc
     1201 cctgaaccaa agcagcaagt tgatttcgct ttttccttaa aacgatttcg tggtatctat
     1261 ctccagaatg cactgcttga aacagttcgt gatatggata tcgtagcgct tgatacccag
     1321 cttgccgagt atgttaataa agcagatctg gcaactctcg caacatacgg tttacgtgca
     1381 gagcttctct tccctgtacc tgttttattg gagaccaatc cttttctttt aggctactat
     1441 cgtcttttaa tgggatacag ccagaaagag ttttatggga aggataaagg cttcaatgct
     1501 ggttgcttca aatccatgga agtgaaaggg aatattggca aagttgcaaa acctaaaata
     1561 tctgaacttt gtcatgcttt ttgctcagtg gcatcttctc ttttgcaagg agttggaccg
     1621 ctgaggatta gtcgggagct tcttgatgac ttgacacttc tcaccgttgg tccacaactt
     1681 cgcgggggcg ccaataatca gcgtggagct gatggtatcg tattagtgtt tgaaataata
     1741 aaagaaattg tttcgcatgc agtggctgag gttagggaga acgctattga ggttaatagt
     1801 gcgacaggcc gaaatgttct aatcgagttt gctccagatc cagatatcat cattcgggaa
     1861 gagatgtccc tcgataacta tcgaaatgtg gttgcaatcg aagttaaaag tggtactgat
     1921 gtttcaaata ttcataatcg tattggtgaa gctgagaaaa gccatcaaaa agcacgaggc
     1981 catggatata cggaatgttg gacggtggtt aatgtatccc gtttagatat ggacaaggct
     2041 cggaaagaat ctccttctac gaatcgattt tattcaataa ctgatttgtc tcttagagaa
     2101 ggagaacaat atgaagattt tagacggcga gttttatcct tgactgcgat ttctgcggct
     2161 ccaacgccat aaaagtcata ttaactgtct tgttcagaat aaggtaaaag ctcgctgatt
     2221 actctcttga acagcaagcc tctaatttta gctgattact ggttactgct ggtttatggg
     2281 atcc
//

Revised: July 5, 2002.
 
 

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH