EMBL-EBITop pageQuery Manager pageResults pageSession Manager pageView Manager pageDataBanks Information PageHelp PageLion Bioscience UK
Text Entry | EmblEntry
                                       
This entry is from:
EMBL
Save
Link
Launch
Printer_Friendly
EMBL:CFCFR91
ID   CFCFR91    standard; DNA; PRO; 2284 BP.
XX
AC   X17022;
XX
SV   X17022.1
XX
DT   12-DEC-1989 (Rel. 22, Created)
DT   26-MAY-1994 (Rel. 39, Last updated, Version 8)
XX
DE   Citrobacter freundii (RFL9) cfr9IM gene for DNA
DE   (Cytosine-4)-Methyltransferase.
XX
KW   cytosine methyltransferase.
XX
OS   Citrobacter freundii
OC   Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;
OC   Citrobacter.
XX
RN   [1]
RX   MEDLINE; 90098846.
RA   Klimasauskas S., Timinskas A., Menkevicius S., Butkiene D., Butkus V.,
RA   Janulaitis A.;
RT   "Sequence motifs characteristic of DNA[cytosine-N4]methyltransferases:
RT   similarity to adenine and cytosine-C5 DNA-methylases";
RL   Nucleic Acids Res. 17:9823-9832(1989).
XX
RN   [2]
RP   1-2284
RA   Lubys A.;
RT   ;
RL   Submitted (29-MAR-1992) to the EMBL/GenBank/DDBJ databases.
RL   Institute of Biotechnology, Gene Engineering Department, Graiciuno 8,
RL   Vilnius, Lithuania, 2028
XX
RN   [3]
RP   1-2284
RX   MEDLINE; 94215893.
RA   Lubys A., Menkevicius S., Timinskas A., Butkus V., Janulaitis A.;
RT   "Cloning and analysis of translational control for genes encoding the Cfr9I
RT   restriction-modification system.";
RL   Gene 141:85-89(1994).
XX
DR   SWISS-PROT; P14243; MTC9_CITFR.
DR   SWISS-PROT; Q60132; T2C9_CITFR.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2284
FT                   /db_xref="taxon:546"
FT                   /organism="Citrobacter freundii"
FT                   /strain="RFL9"
FT                   /clone="clone pCfr9IRM2.3"
FT   CDS             281..1183
FT                   /db_xref="SWISS-PROT:P14243"
FT                   /transl_table=11
FT                   /function="Methyl transfer"
FT                   /product="DNA  (Cytosine-4)-Methyltransferase"
FT                   /gene="cfr9IM"
FT                   /standard_name="Cfr9I methyltransferase"
FT                   /protein_id="CAA34887.1"
FT                   /translation="MPSKKSSSPLSVEKLHRSEPLELNGATLFEGDALSVLRRLPSGSV
FT                   RCIVTSPPYWGLRDYGIDEQIGLESSMTQFLNRLVTIFSEAKRVLTDDGTLWVNIGDGY
FT                   TSGNRGYRAPDKKNPARAMAVRPDTPEGLKPKDLIGIPWRLAFALQEDGWYLRSDIVWN
FT                   KPNAMPESVKDRPTRSHEFLFMLTKSEKYYYDWEAVREEKDSGGFRNRRTVWNVNTKPF
FT                   AGAHFATFPTELIRPCILASTKPGDYVLDPFFGSGTVGVVCQQEDRQYVGIELNPEYVD
FT                   IAVNRLQGEDTNVIRIAAA"
FT   CDS             1180..2172
FT                   /db_xref="SWISS-PROT:Q60132"
FT                   /evidence=EXPERIMENTAL
FT                   /transl_table=11
FT                   /function="DNA cleavage"
FT                   /product="Restriction  Endonuclease"
FT                   /gene="cfr9IR"
FT                   /standard_name="Cfr9I restriction  endonuclease"
FT                   /protein_id="CAA34888.1"
FT                   /translation="MTNKIVFPEPKQQVDFAFSLKRFRGIYLQNALLETVRDMDIVALD
FT                   TQLAEYVNKADLATLATYGLRAELLFPVPVLLETNPFLLGYYRLLMGYSQKEFYGKDKG
FT                   FNAGCFKSMEVKGNIGKVAKPKISELCHAFCSVASSLLQGVGPLRISRELLDDLTLLTV
FT                   GPQLRGGANNQRGADGIVLVFEIIKEIVSHAVAEVRENAIEVNSATGRNVLIEFAPDPD
FT                   IIIREEMSLDNYRNVVAIEVKSGTDVSNIHNRIGEAEKSHQKARGHGYTECWTVVNVSR
FT                   LDMDKARKESPSTNRFYSITDLSLREGEQYEDFRRRVLSLTAISAAPTP"
XX
SQ   Sequence 2284 BP; 624 A; 438 C; 570 G; 652 T; 0 other;
     aagggaagcc taaccagacc gggaaagggt ctggctctgc cgtggtgttc accgagccat        60
     aaacgatcgg tactcgataa gagagcggtt aactgacaat ctgatgatac gccccggcgc       120
     ttttgttggt atgcccaaaa cggcgctaaa cggtcgctat tgtctgcttt tagttcggta       180
     aggctgttgt tggagtatct gatgacgttt acactactgg cccagataga tttaaaagtt       240
     gtaggttgtt gcatgtctgc attgtgcgtg aggaatattt atgccaagta aaaagagtag       300
     ttcgccgctg agtgttgaga aacttcatcg ttctgagccc ttggagttga acggagctac       360
     gctttttgaa ggtgatgctc tgtcagtatt gaggagactt ccgagcggct cagttcggtg       420
     catcgtcact tctccgccat actgggggct acgtgattac ggcatagatg aacaaatcgg       480
     tttagaaagt agcatgactc agtttttaaa tcgtcttgtt acgatctttt ctgaggcgaa       540
     acgtgtattg actgacgacg gaacgctatg ggttaacatt ggtgatggat atacaagcgg       600
     aaatcgcggg tatagagctc ctgataagaa aaatccggca cgagctatgg ctgttcgccc       660
     ggatacgcca gaaggactaa aaccgaagga tctgattggg attccttggc ggttagcgtt       720
     cgctttgcaa gaagatgggt ggtacctacg aagcgacatt gtttggaata aacctaacgc       780
     gatgcctgaa agtgtaaaag accggcctac ccgttctcat gagttccttt ttatgctgac       840
     caaatcagag aaatattatt acgattggga agcggtgaga gaagaaaaag atagcggagg       900
     tttcagaaat cgacgcacag tatggaatgt aaatacgaaa ccttttgcag gggctcattt       960
     cgcaacattc ccaacggagc taattcgtcc atgcatcttg gcatccacga aacctggtga      1020
     ttacgtatta gatccattct tcggctctgg tactgtaggc gttgtatgcc agcaggaaga      1080
     ccgccagtat gttggtattg aactcaatcc agaatatgtt gatatagctg taaatcgttt      1140
     gcagggtgag gatacaaatg tgataaggat cgcggcagca tgactaataa aatagttttc      1200
     cctgaaccaa agcagcaagt tgatttcgct ttttccttaa aacgatttcg tggtatctat      1260
     ctccagaatg cactgcttga aacagttcgt gatatggata tcgtagcgct tgatacccag      1320
     cttgccgagt atgttaataa agcagatctg gcaactctcg caacatacgg tttacgtgca      1380
     gagcttctct tccctgtacc tgttttattg gagaccaatc cttttctttt aggctactat      1440
     cgtcttttaa tgggatacag ccagaaagag ttttatggga aggataaagg cttcaatgct      1500
     ggttgcttca aatccatgga agtgaaaggg aatattggca aagttgcaaa acctaaaata      1560
     tctgaacttt gtcatgcttt ttgctcagtg gcatcttctc ttttgcaagg agttggaccg      1620
     ctgaggatta gtcgggagct tcttgatgac ttgacacttc tcaccgttgg tccacaactt      1680
     cgcgggggcg ccaataatca gcgtggagct gatggtatcg tattagtgtt tgaaataata      1740
     aaagaaattg tttcgcatgc agtggctgag gttagggaga acgctattga ggttaatagt      1800
     gcgacaggcc gaaatgttct aatcgagttt gctccagatc cagatatcat cattcgggaa      1860
     gagatgtccc tcgataacta tcgaaatgtg gttgcaatcg aagttaaaag tggtactgat      1920
     gtttcaaata ttcataatcg tattggtgaa gctgagaaaa gccatcaaaa agcacgaggc      1980
     catggatata cggaatgttg gacggtggtt aatgtatccc gtttagatat ggacaaggct      2040
     cggaaagaat ctccttctac gaatcgattt tattcaataa ctgatttgtc tcttagagaa      2100
     ggagaacaat atgaagattt tagacggcga gttttatcct tgactgcgat ttctgcggct      2160
     ccaacgccat aaaagtcata ttaactgtct tgttcagaat aaggtaaaag ctcgctgatt      2220
     actctcttga acagcaagcc tctaatttta gctgattact ggttactgct ggtttatggg      2280
     atcc                                                                   2284
//

SRS 6.1.3.11 |  feedback