Lion Bioscience UKTop pageQuery Manager pageResults pageSession Manager pageView Manager pageDataBanks Information PageHelp Page
                                        View
This entry is from:
DDBJ
Save
Link
Launch
Printer_Friendly
DDBJ:CFCFR91
LOCUS       CFCFR91                 2284 bp    DNA     linear   BCT 26-MAY-1994
DEFINITION  Citrobacter freundii (RFL9) cfr9IM gene for DNA
            (Cytosine-4)-Methyltransferase.
ACCESSION   X17022
VERSION     X17022.1
KEYWORDS    cytosine methyltransferase.
SOURCE      Citrobacter freundii.
  ORGANISM  Citrobacter freundii
            Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae;
            Citrobacter.
REFERENCE   1 
  AUTHORS   Klimasauskas,S., Timinskas,A., Menkevicius,S., Butkiene,D., 
            Butkus,V. and Janulaitis,A. 
  TITLE     Sequence motifs characteristic of 
            DNA[cytosine-N4]methyltransferases: similarity to adenine and 
            cytosine-C5 DNA-methylases 
  JOURNAL   Nucleic Acids Res. 17, 9823-9832(1989). 
  MEDLINE   90098846
REFERENCE   2  (bases 1 to 2284)
  AUTHORS   Lubys,A. 
  JOURNAL   Submitted (29-MAR-1992) to the EMBL/GenBank/DDBJ databases. 
            Institute of Biotechnology, Gene Engineering Department, Graiciuno 
            8, Vilnius, Lithuania, 2028 
REFERENCE   3  (bases 1 to 2284)
  AUTHORS   Lubys,A., Menkevicius,S., Timinskas,A., Butkus,V. and Janulaitis,A. 
  TITLE     Cloning and analysis of translational control for genes encoding the
            Cfr9I restriction-modification system. 
  JOURNAL   Gene 141, 85-89(1994). 
  MEDLINE   94215893
FEATURES             Location/Qualifiers
     source          1..2284
                     /db_xref="taxon:546"
                     /organism="Citrobacter freundii"
                     /strain="RFL9"
                     /clone="clone pCfr9IRM2.3"
     CDS             281..1183
                     /db_xref="SWISS-PROT:P14243"
                     /transl_table=11
                     /function="Methyl transfer"
                     /product="DNA  (Cytosine-4)-Methyltransferase"
                     /gene="cfr9IM"
                     /standard_name="Cfr9I methyltransferase"
                     /protein_id="CAA34887.1"
                     /translation="MPSKKSSSPLSVEKLHRSEPLELNGATLFEGDALSVLRRLPSGSV
                     RCIVTSPPYWGLRDYGIDEQIGLESSMTQFLNRLVTIFSEAKRVLTDDGTLWVNIGDGY
                     TSGNRGYRAPDKKNPARAMAVRPDTPEGLKPKDLIGIPWRLAFALQEDGWYLRSDIVWN
                     KPNAMPESVKDRPTRSHEFLFMLTKSEKYYYDWEAVREEKDSGGFRNRRTVWNVNTKPF
                     AGAHFATFPTELIRPCILASTKPGDYVLDPFFGSGTVGVVCQQEDRQYVGIELNPEYVD
                     IAVNRLQGEDTNVIRIAAA"
     CDS             1180..2172
                     /db_xref="SWISS-PROT:Q60132"
                     /evidence=EXPERIMENTAL
                     /transl_table=11
                     /function="DNA cleavage"
                     /product="Restriction  Endonuclease"
                     /gene="cfr9IR"
                     /standard_name="Cfr9I restriction  endonuclease"
                     /protein_id="CAA34888.1"
                     /translation="MTNKIVFPEPKQQVDFAFSLKRFRGIYLQNALLETVRDMDIVALD
                     TQLAEYVNKADLATLATYGLRAELLFPVPVLLETNPFLLGYYRLLMGYSQKEFYGKDKG
                     FNAGCFKSMEVKGNIGKVAKPKISELCHAFCSVASSLLQGVGPLRISRELLDDLTLLTV
                     GPQLRGGANNQRGADGIVLVFEIIKEIVSHAVAEVRENAIEVNSATGRNVLIEFAPDPD
                     IIIREEMSLDNYRNVVAIEVKSGTDVSNIHNRIGEAEKSHQKARGHGYTECWTVVNVSR
                     LDMDKARKESPSTNRFYSITDLSLREGEQYEDFRRRVLSLTAISAAPTP"
BASE COUNT      624 a    438 c    570 g    652 t
ORIGIN
       1  aagggaagcc taaccagacc gggaaagggt ctggctctgc cgtggtgttc accgagccat
      61  aaacgatcgg tactcgataa gagagcggtt aactgacaat ctgatgatac gccccggcgc
     121  ttttgttggt atgcccaaaa cggcgctaaa cggtcgctat tgtctgcttt tagttcggta
     181  aggctgttgt tggagtatct gatgacgttt acactactgg cccagataga tttaaaagtt
     241  gtaggttgtt gcatgtctgc attgtgcgtg aggaatattt atgccaagta aaaagagtag
     301  ttcgccgctg agtgttgaga aacttcatcg ttctgagccc ttggagttga acggagctac
     361  gctttttgaa ggtgatgctc tgtcagtatt gaggagactt ccgagcggct cagttcggtg
     421  catcgtcact tctccgccat actgggggct acgtgattac ggcatagatg aacaaatcgg
     481  tttagaaagt agcatgactc agtttttaaa tcgtcttgtt acgatctttt ctgaggcgaa
     541  acgtgtattg actgacgacg gaacgctatg ggttaacatt ggtgatggat atacaagcgg
     601  aaatcgcggg tatagagctc ctgataagaa aaatccggca cgagctatgg ctgttcgccc
     661  ggatacgcca gaaggactaa aaccgaagga tctgattggg attccttggc ggttagcgtt
     721  cgctttgcaa gaagatgggt ggtacctacg aagcgacatt gtttggaata aacctaacgc
     781  gatgcctgaa agtgtaaaag accggcctac ccgttctcat gagttccttt ttatgctgac
     841  caaatcagag aaatattatt acgattggga agcggtgaga gaagaaaaag atagcggagg
     901  tttcagaaat cgacgcacag tatggaatgt aaatacgaaa ccttttgcag gggctcattt
     961  cgcaacattc ccaacggagc taattcgtcc atgcatcttg gcatccacga aacctggtga
    1021  ttacgtatta gatccattct tcggctctgg tactgtaggc gttgtatgcc agcaggaaga
    1081  ccgccagtat gttggtattg aactcaatcc agaatatgtt gatatagctg taaatcgttt
    1141  gcagggtgag gatacaaatg tgataaggat cgcggcagca tgactaataa aatagttttc
    1201  cctgaaccaa agcagcaagt tgatttcgct ttttccttaa aacgatttcg tggtatctat
    1261  ctccagaatg cactgcttga aacagttcgt gatatggata tcgtagcgct tgatacccag
    1321  cttgccgagt atgttaataa agcagatctg gcaactctcg caacatacgg tttacgtgca
    1381  gagcttctct tccctgtacc tgttttattg gagaccaatc cttttctttt aggctactat
    1441  cgtcttttaa tgggatacag ccagaaagag ttttatggga aggataaagg cttcaatgct
    1501  ggttgcttca aatccatgga agtgaaaggg aatattggca aagttgcaaa acctaaaata
    1561  tctgaacttt gtcatgcttt ttgctcagtg gcatcttctc ttttgcaagg agttggaccg
    1621  ctgaggatta gtcgggagct tcttgatgac ttgacacttc tcaccgttgg tccacaactt
    1681  cgcgggggcg ccaataatca gcgtggagct gatggtatcg tattagtgtt tgaaataata
    1741  aaagaaattg tttcgcatgc agtggctgag gttagggaga acgctattga ggttaatagt
    1801  gcgacaggcc gaaatgttct aatcgagttt gctccagatc cagatatcat cattcgggaa
    1861  gagatgtccc tcgataacta tcgaaatgtg gttgcaatcg aagttaaaag tggtactgat
    1921  gtttcaaata ttcataatcg tattggtgaa gctgagaaaa gccatcaaaa agcacgaggc
    1981  catggatata cggaatgttg gacggtggtt aatgtatccc gtttagatat ggacaaggct
    2041  cggaaagaat ctccttctac gaatcgattt tattcaataa ctgatttgtc tcttagagaa
    2101  ggagaacaat atgaagattt tagacggcga gttttatcct tgactgcgat ttctgcggct
    2161  ccaacgccat aaaagtcata ttaactgtct tgttcagaat aaggtaaaag ctcgctgatt
    2221  actctcttga acagcaagcc tctaatttta gctgattact ggttactgct ggtttatggg
    2281  atcc
//

SRS 6.1.3.10 |  feedback